Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReplication protein E1
LigandBDBM50137898
Substrate/Competitorn/a
Meas. Tech.ChEBML_84985
IC50 340±n/a nM
Citation Faucher AMWhite PWBrochu CGrand-Maître CRancourt JFazal G Discovery of small-molecule inhibitors of the ATPase activity of human papillomavirus E1 helicase. J Med Chem 47:18-21 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Replication protein E1
Name:Replication protein E1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:73515.58
Organism:Human papillomavirus type 11
Description:ChEMBL_84985
Residue:649
Sequence:
MADDSGTENEGSGCTGWFMVEAIVEHTTGTQISEDEEEEVEDSGYDMVDFIDDRHITQNS
VEAQALFNRQEADAHYATVQDLKRKYLGSPYVSPISNVANAVESEISPRLDAIKLTTQPK
KVKRRLFETRELTDSGYGYSEVEAATQVEKHGDPENGGDGQERDTGRDIEGEGVEHREAE
AVDDSTREHADTSGILELLKCKDIRSTLHGKFKDCFGLSFVDLIRPFKSDRTTCADWVVA
GFGIHHSIADAFQKLIEPLSLYAHIQWLTNAWGMVLLVLIRFKVNKSRCTVARTLGTLLN
IPENHMLIEPPKIQSGVRALYWFRTGISNASTVIGEAPEWITRQTVIEHSLADSQFKLTE
MVQWAYDNDICEESEIAFEYAQRGDFDSNARAFLNSNMQAKYVKDCAIMCRHYKHAEMKK
MSIKQWIKYRGTKVDSVGNWKPIVQFLRHQNIEFIPFLSKLKLWLHGTPKKNCIAIVGPP
DTGKSCFCMSLIKFLGGTVISYVNSCSHFWLQPLTDAKVALLDDATQPCWTYMDTYMRNL
LDGNPMSIDRKHRALTLIKCPPLLVTSNIDISKEEKYKYLHSRVTTFTFPNPFPFDRNGN
AVYELSDANWKCFFERLSSSLDIEDSEDEEDGSNSQAFRCVPGSVVRTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50137898
n/a
NameBDBM50137898
Synonyms:(4'-Benzylcarbamoylmethyl-biphenyl-4-sulfonyl)-acetic acid | CHEMBL173195 | [4'-(Benzylcarbamoyl-methyl)-biphenyl-4-sulfonyl]-acetic acid
TypeSmall organic molecule
Emp. Form.C23H21NO5S
Mol. Mass.423.482
SMILESOC(=O)CS(=O)(=O)c1ccc(cc1)-c1ccc(CC(=O)NCc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: