Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA helicase/primase complex protein
LigandBDBM50137912
Substrate/Competitorn/a
Meas. Tech.ChEBML_84513
IC50>80000±n/a nM
Citation Faucher AMWhite PWBrochu CGrand-Maître CRancourt JFazal G Discovery of small-molecule inhibitors of the ATPase activity of human papillomavirus E1 helicase. J Med Chem 47:18-21 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA helicase/primase complex protein
Name:DNA helicase/primase complex protein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:114429.27
Organism:Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus1)
Description:ChEMBL_84513
Residue:1058
Sequence:
MGQEDGNRGERRAAGTPVEVTALYATDGCVITSSIALLTNSLLGAEPVYIFSYDAYTHDG
RADGPTEQDRFEESRALYQASGGLNGDSFRVTFCLLGTEVGGTHQARGRTRPMFVCRFER
ADDVAALQDALAHGTPLQPDHIAATLDAEATFALHANMILALTVAINNASPRTGRDAAAA
QYDQGASLRSLVGRTSLGQRGLTTLYVHHEVRVLAAYRRAYYGSAQSPFWFLSKFGPDEK
SLVLTTRYYLLQAQRLGGAGATYDLQAIKDICATYAIPHAPRPDTVSAASLTSFAAITRF
CCTSQYARGAAAAGFPLYVERRIAADVRETSALEKFITHDRSCLRVSDREFITYIYLAHF
ECFSPPRLATHLRAVTTHDPNPAASTEQPSPLGREAVEQFFCHVRAQLNIGEYVKHNVTP
RETVLDGDTAKAYLRARTYAPGALTPAPAYCGAVDSATKMMGRLADAEKLLVPRGWPAFA
PASPGEDTAGGTPPPQTCGIVKRLLRLAATEQQGPTPPAIAALIRNAAVQTPLPVYRISM
VPTGQAFAALAWDDWARITRDARLAEAVVSAEAAAHPDHGALGRRLTDRIRAQGPVMPPG
GLDAGGQMYVNRNEIFNGALAITNIILDLDIALKEPVPFRRLHEALGHFRRGALAAVQLL
FPAARVDPDAYPCYFFKSACRPGPASVGSGSGLGNDDDGDWFPCYDDAGDEEWAEDPGAM
DTSHDPPDDEVAYFDLCHEVGPTAEPRETDSPVCSCTDKIGLRVCMPVPAPYVVHGSLTM
RGVARVIQQAVLLDRDFVEAIGSYVKNFLLIDTGVYAHGHSLRLPYFAKIAPDGPACGRL
LPVFVIPPACKDVPAFVAAHADPRRFHFHAPPTYLASPREIRVLHSLGGDYVSFFERKAS
RNALEHFGRRETLTEVLGRYNVQPDAGGTVEGFASELLGRIVACIETHFPEHAGEYQAVS
VRRAVSKDDWVLLQLVPVRGTLQQSLSCLRFKHGRASRATARTFVALSVGANNRLCVSLC
QQCFAAKCDSNRLHTLFTIDAGTPCSPSVPCSTSQPSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50137912
n/a
NameBDBM50137912
Synonyms:(Biphenyl-4-sulfinyl)-acetic acid | (Biphenyl-4-sulfonyl)-acetic acid | 2-(biphenyl-4-ylsulfonyl)acetic acid | CHEMBL178590
TypeSmall organic molecule
Emp. Form.C14H12O4S
Mol. Mass.276.308
SMILESOC(=O)CS(=O)(=O)c1ccc(cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: