| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50138002 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145149 (CHEMBL755953) |
|---|
| Ki | 19±n/a nM |
|---|
| Citation |  Zhang, A; Xiong, W; Bidlack, JM; Hilbert, JE; Knapp, BI; Wentland, MP; Neumeyer, JL 10-Ketomorphinan and 3-substituted-3-desoxymorphinan analogues as mixed kappa and micro opioid ligands: synthesis and biological evaluation of their binding affinity at opioid receptors. J Med Chem47:165-74 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50138002 |
|---|
| n/a |
|---|
| Name | BDBM50138002 |
|---|
| Synonyms: | 3-Hydroxy-10-keto-N-(3,3-dimethylallyl)morphinan | CHEMBL295402 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H27NO2 |
|---|
| Mol. Mass. | 325.4446 |
|---|
| SMILES | [#6]\[#6](-[#6])=[#6]\[#6]-[#7]-1-[#6]-[#6][C@]23[#6]-[#6]-[#6]-[#6]-[#6@H]2-[#6@H]-1-[#6](=O)-c1ccc(-[#8])cc31 |
|---|
| Structure | 
|
|---|
Search and Browse
