Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInhibitor of NF-kappa-B kinase (IKK)
LigandBDBM50138400
Substrate/Competitorn/a
Meas. Tech.ChEBML_90391
IC50 3802±n/a nM
Citation Bingham AHDavenport RJGowers LKnight RLLowe COwen DAParry DMPitt WR A novel series of potent and selective IKK2 inhibitors. Bioorg Med Chem Lett 14:409-12 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Inhibitor of NF-kappa-B kinase (IKK)
Name:Inhibitor of NF-kappa-B kinase alpha/beta
Synonyms:Inhibitor of nuclear factor kappa B kinase alpha subunit
Type:PROTEIN
Mol. Mass.:84642.21
Organism:Homo sapiens (Human)
Description:ChEMBL_327453
Residue:745
Sequence:
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138400
n/a
NameBDBM50138400
Synonyms:4-{4-[4-(Piperazine-1-sulfonyl)-phenyl]-pyrimidin-2-ylamino}-benzonitrile | CHEMBL132416
TypeSmall organic molecule
Emp. Form.C21H20N6O2S
Mol. Mass.420.487
SMILESO=S(=O)(N1CCNCC1)c1ccc(cc1)-c1ccnc(Nc2ccc(cc2)C#N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: