Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPalmitoyl-CoA oxidase
LigandBDBM50138628
Substrate/Competitorn/a
Meas. Tech.ChEBML_154606
IC50 105±n/a nM
Citation Koltun DOMarquart TAShenk KDElzein ELi YNguyen MKerwar SZeng DChu NSoohoo DHao JMaydanik VYLustig DANg KJFraser HZablocki JA New fatty acid oxidation inhibitors with increased potency lacking adverse metabolic and electrophysiological properties. Bioorg Med Chem Lett 14:549-52 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Palmitoyl-CoA oxidase
Name:Palmitoyl-CoA oxidase
Synonyms:AOX | Peroxisomal acyl-CoA oxidase 1, A chain | Peroxisomal acyl-CoA oxidase 1, B chain | Peroxisomal acyl-CoA oxidase 1, C chain | Peroxisomal acyl-coenzyme A oxidase 1
Type:PROTEIN
Mol. Mass.:74693.04
Organism:Rattus norvegicus
Description:ChEMBL_311972
Residue:661
Sequence:
MNPDLRKERASATFNPELITHILDGSPENTRRRREIENLILNDPDFQHEDYNFLTRSQRY
EVAVKKSATMVKKMREYGISDPEEIMWFKKLYLANFVEPVGLNYSMFIPTLLNQGTTAQQ
EKWMRPSQELQIIGTYAQTEMGHGTHLRGLETTATYDPKTQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITQGECYGLHAFVVPIREIGTHKPLPGITVGDIGPKFGYEEMDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGNAAQSLSKACTIA
IRYSAVRRQSEIKQSEPEPQILDFQTQQYKLFPLLATAYAFHFVGRYMKETYLRINESIG
QGDLSELPELHALTAGLKAFTTWTANAGIEECRMACGGHGYSHSSGIPNIYVTFTPACTF
EGENTVMMLQTARFLMKIYDQVRSGKLVGGMVSYLNDLPSQRIQPQQVAVWPTMVDINSL
EGLTEAYKLRAARLVEIAAKNLQTHVSHRKSKEVAWNLTSVDLVRASEAHCHYVVVKVFS
DKLPKIQDKAVQAVLRNLCLLYSLYGISQKGGDFLEGSIITGAQLSQVNARILELLTLIR
PNAVALVDAFDFKDMTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYHKHLKPLQSK
L
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138628
n/a
NameBDBM50138628
Synonyms:2-{4-[(R)-2-Hydroxy-3-(2-methyl-benzothiazol-5-yloxy)-propyl]-piperazin-1-yl}-N-naphthalen-1-yl-acetamide | CHEMBL153426
TypeSmall organic molecule
Emp. Form.C27H30N4O3S
Mol. Mass.490.617
SMILESCc1nc2cc(OC[C@H](O)CN3CCN(CC(=O)Nc4cccc5ccccc45)CC3)ccc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: