Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50138667 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_212906 (CHEMBL819934) |
---|
Ki | 42±n/a nM |
---|
Citation | Wendt, MD; Rockway, TW; Geyer, A; McClellan, W; Weitzberg, M; Zhao, X; Mantei, R; Nienaber, VL; Stewart, K; Klinghofer, V; Giranda, VL Identification of novel binding interactions in the development of potent, selective 2-naphthamidine inhibitors of urokinase. Synthesis, structural analysis, and SAR of N-phenyl amide 6-substitution. J Med Chem47:303-24 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
Type: | Enzyme |
Mol. Mass.: | 26557.80 |
Organism: | Homo sapiens (Human) |
Description: | P07477 |
Residue: | 247 |
Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
BDBM50138667 |
---|
n/a |
---|
Name | BDBM50138667 |
Synonyms: | 6-Carbamimidoyl-naphthalene-2-carboxylic acid (1-isopropyl-3,4-dihydro-isoquinolin-7-yl)-amide | 6-[(Z)-AMINO(IMINO)METHYL]-N-(1-ISOPROPYL-3,4-DIHYDROISOQUINOLIN-7-YL)-2-NAPHTHAMIDE | 6-carbamimidoyl-N-(1-isopropyl-3,4-dihydroisoquinolin-7-yl)-2-naphthamide | CHEMBL109367 |
Type | Small organic molecule |
Emp. Form. | C24H24N4O |
Mol. Mass. | 384.4736 |
SMILES | CC(C)C1=NCCc2ccc(NC(=O)c3ccc4cc(ccc4c3)C(N)=N)cc12 |t:3| |
Structure |
|