Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoprotein lipase
LigandBDBM50138734
Substrate/Competitorn/a
Meas. Tech.ChEMBL_101166
IC50>10000±n/a nM
Citation Ebdrup SSørensen LGOlsen OHJacobsen P Synthesis and structure-activity relationship for a novel class of potent and selective carbamoyl-triazole based inhibitors of hormone sensitive lipase. J Med Chem 47:400-10 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lipoprotein lipase
Name:Lipoprotein lipase
Synonyms:LPL
Type:PROTEIN
Mol. Mass.:53173.96
Organism:Homo sapiens (Human)
Description:ChEMBL_1280894
Residue:475
Sequence:
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138734
n/a
NameBDBM50138734
Synonyms:3-(3-(benzyloxy)phenyl)-5-ethoxy-1,3,4-oxadiazol-2(3H)-one | 3-(3-Benzyloxy-phenyl)-5-ethoxy-3H-[1,3,4]oxadiazol-2-one | CHEMBL133897
TypeSmall organic molecule
Emp. Form.C17H16N2O4
Mol. Mass.312.3199
SMILESCCOc1nn(-c2cccc(OCc3ccccc3)c2)c(=O)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: