Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50138900 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_46977 (CHEMBL659744) |
---|
Ki | >1000±n/a nM |
---|
Citation | Lange, JH; Coolen, HK; van Stuivenberg, HH; Dijksman, JA; Herremans, AH; Ronken, E; Keizer, HG; Tipker, K; McCreary, AC; Veerman, W; Wals, HC; Stork, B; Verveer, PC; den Hartog, AP; de Jong, NM; Adolfs, TJ; Hoogendoorn, J; Kruse, CG Synthesis, biological properties, and molecular modeling investigations of novel 3,4-diarylpyrazolines as potent and selective CB(1) cannabinoid receptor antagonists. J Med Chem47:627-43 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50138900 |
---|
n/a |
---|
Name | BDBM50138900 |
Synonyms: | CHEMBL157591 | N-[1-[3-(4-Chloro-phenyl)-4-phenyl-4,5-dihydro-pyrazol-1-yl]-1-methylamino-meth-(E)-ylidene]-3-trifluoromethyl-benzenesulfonamide |
Type | Small organic molecule |
Emp. Form. | C24H20ClF3N4O2S |
Mol. Mass. | 520.954 |
SMILES | CN=C(NS(=O)(=O)c1cccc(c1)C(F)(F)F)N1CC(C(=N1)c1ccc(Cl)cc1)c1ccccc1 |w:1.0,c:21| |
Structure |
|