Reaction Details |
| Report a problem with these data |
Target | Melanocortin receptor 5 |
---|
Ligand | BDBM50139028 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_106654 (CHEMBL712999) |
---|
Ki | 1400±n/a nM |
---|
Citation | Richardson, TI; Ornstein, PL; Briner, K; Fisher, MJ; Backer, RT; Biggers, CK; Clay, MP; Emmerson, PJ; Hertel, LW; Hsiung, HM; Husain, S; Kahl, SD; Lee, JA; Lindstrom, TD; Martinelli, MJ; Mayer, JP; Mullaney, JT; O'Brien, TP; Pawlak, JM; Revell, KD; Shah, J; Zgombick, JM; Herr, RJ; Melekhov, A; Sampson, PB; King, CH Synthesis and structure-activity relationships of novel arylpiperazines as potent and selective agonists of the melanocortin subtype-4 receptor. J Med Chem47:744-55 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocortin receptor 5 |
---|
Name: | Melanocortin receptor 5 |
Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
Type: | Enzyme |
Mol. Mass.: | 36612.92 |
Organism: | Homo sapiens (Human) |
Description: | P33032 |
Residue: | 325 |
Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
BDBM50139028 |
---|
n/a |
---|
Name | BDBM50139028 |
Synonyms: | (R)-1,2,3,4-Tetrahydro-isoquinoline-3-carboxylic acid {(R)-1-(4-chloro-benzyl)-2-[4-(2-dimethylaminomethyl-phenyl)-piperazin-1-yl]-2-oxo-ethyl}-amide | 1,2,3,4-Tetrahydro-isoquinoline-3-carboxylic acid {(R)-1-(4-chloro-benzyl)-2-[4-(2-dimethylaminomethyl-phenyl)-piperazin-1-yl]-2-oxo-ethyl}-amide | CHEMBL349850 |
Type | Small organic molecule |
Emp. Form. | C32H38ClN5O2 |
Mol. Mass. | 560.129 |
SMILES | CN(C)Cc1ccccc1N1CCN(CC1)C(=O)[C@@H](Cc1ccc(Cl)cc1)NC(=O)[C@H]1Cc2ccccc2CN1 |
Structure |
|