Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG2/mitotic-specific cyclin B1
LigandBDBM50140088
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144034
IC50 367±n/a nM
Citation Loughnan MLNicke AJones AAdams DJAlewood PFLewis RJ Chemical and functional identification and characterization of novel sulfated alpha-conotoxins from the cone snail Conus anemone. J Med Chem 47:1234-41 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G2/mitotic-specific cyclin B1
Name:G2/mitotic-specific cyclin B1
Synonyms:G2/mitotic-specific cyclin-B1
Type:PROTEIN
Mol. Mass.:47397.83
Organism:Rattus norvegicus
Description:ChEMBL_144034
Residue:423
Sequence:
MALRVTRNTKINTENKAKVSMAGAKRVPVAVAASKPLLRSRTALGDIGNKVSEQSRIPLK
KETKKLGSGTVTVKALPKPVDKVPVCEPEVELDEPEPEPVMEVKHSPEPILVDTPSPSPM
ETSGCAPAEEYLCQAFSDVILAVSDVDADDGGDPNLCSEYVKDIYAYLRQLEEEQSVRPK
YLLGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQDSCVPKKMLQLVGVT
AMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRAS
KIGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQIAAGAFCLALKILDNGEWTPTLQHYLS
HTEESLLPVMQHLAKNIVMVNRGLTKHMTIKNKYATSKHAKISTLAQLNCTLVQNLSKAV
TKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50140088
n/a
NameBDBM50140088
Synonyms:CHEMBL451251 | GGCCSHPACAANNQDYC#
TypeSmall organic molecule
Emp. Form.C65H96N22O25S4
Mol. Mass.1713.85
SMILESC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H]1CCCN1C(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)CNC(=O)CN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: