Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50452034
Substrate/Competitorn/a
Meas. Tech.ChEBML_105264
Ki 0.190000±n/a nM
Citation Sun LQChen JTakaki KJohnson GIben LMahle CDRyan EXu C Design and synthesis of benzoxazole derivatives as novel melatoninergic ligands. Bioorg Med Chem Lett 14:1197-200 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50452034
n/a
NameBDBM50452034
Synonyms:CHEMBL2112724
TypeSmall organic molecule
Emp. Form.C17H20N2O2
Mol. Mass.284.3529
SMILESCCc1nc2cccc([C@@H]3C[C@H]3CNC(=O)C3CC3)c2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: