| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vitamin K-dependent protein C |
|---|
| Ligand | BDBM50140407 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_27867 |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Jia, ZJ; Wu, Y; Huang, W; Zhang, P; Song, Y; Woolfrey, J; Sinha, U; Arfsten, AE; Edwards, ST; Hutchaleelaha, A; Hollennbach, SJ; Lambing, JL; Scarborough, RM; Zhu, BY 1-(2-Naphthyl)-1H-pyrazole-5-carboxylamides as potent factor Xa inhibitors. Part 3: Design, synthesis and SAR of orally bioavailable benzamidine-P4 inhibitors. Bioorg Med Chem Lett14:1229-34 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Vitamin K-dependent protein C |
|---|
| Name: | Vitamin K-dependent protein C |
|---|
| Synonyms: | Activated protein C cofactor | Anticoagulant protein C | Apolipoprotein H | Autoprothrombin IIA | Blood coagulation factor XIV | Coagulation factor V | Coagulation factor V heavy chain | Coagulation factor V light chain | Endothelial protein C receptor | PROC | PROC_HUMAN | Proaccelerin, labile factor | Vitamin K-dependent protein C precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 52067.73 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 461 |
|---|
| Sequence: | MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
|
|
|
|---|
| BDBM50140407 |
|---|
| n/a |
|---|
| Name | BDBM50140407 |
|---|
| Synonyms: | 2-(3-Fluoro-naphthalen-2-yl)-5-methyl-2H-pyrazole-3-carboxylic acid [4-(N,N-dimethyl-carbamimidoyl)-2-fluoro-phenyl]-amide | CHEMBL21140 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H21F2N5O |
|---|
| Mol. Mass. | 433.4532 |
|---|
| SMILES | CN(C)C(=N)c1ccc(NC(=O)c2cc(C)nn2-c2cc3ccccc3cc2F)c(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
