Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 1 |
---|
Ligand | BDBM50140796 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_44673 (CHEMBL656546) |
---|
IC50 | 15100±n/a nM |
---|
Citation | Widdowson, KL; Elliott, JD; Veber, DF; Nie, H; Rutledge, MC; McCleland, BW; Xiang, JN; Jurewicz, AJ; Hertzberg, RP; Foley, JJ; Griswold, DE; Martin, L; Lee, JM; White, JR; Sarau, HM Evaluation of potent and selective small-molecule antagonists for the CXCR2 chemokine receptor. J Med Chem47:1319-21 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 1 |
---|
Name: | C-X-C chemokine receptor type 1 |
Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
Type: | Enzyme |
Mol. Mass.: | 39803.83 |
Organism: | Homo sapiens (Human) |
Description: | P25024 |
Residue: | 350 |
Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
BDBM50140796 |
---|
n/a |
---|
Name | BDBM50140796 |
Synonyms: | 1-(2-Bromo-phenyl)-3-(4-cyano-2-hydroxy-phenyl)-urea | 1-(2-bromophenyl)-3-(4-cyano-2-hydroxyphenyl)urea | CHEMBL27863 |
Type | Small organic molecule |
Emp. Form. | C14H10BrN3O2 |
Mol. Mass. | 332.152 |
SMILES | Oc1cc(ccc1NC(=O)Nc1ccccc1Br)C#N |
Structure |
|