| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 1 |
|---|
| Ligand | BDBM50140793 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_44673 (CHEMBL656546) |
|---|
| IC50 | 33200.0±n/a nM |
|---|
| Citation |  Widdowson, KL; Elliott, JD; Veber, DF; Nie, H; Rutledge, MC; McCleland, BW; Xiang, JN; Jurewicz, AJ; Hertzberg, RP; Foley, JJ; Griswold, DE; Martin, L; Lee, JM; White, JR; Sarau, HM Evaluation of potent and selective small-molecule antagonists for the CXCR2 chemokine receptor. J Med Chem47:1319-21 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 1 |
|---|
| Name: | C-X-C chemokine receptor type 1 |
|---|
| Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39803.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25024 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
|---|
| BDBM50140793 |
|---|
| n/a |
|---|
| Name | BDBM50140793 |
|---|
| Synonyms: | 1-(2-Hydroxy-3-nitro-phenyl)-3-phenyl-urea | CHEMBL283736 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H11N3O4 |
|---|
| Mol. Mass. | 273.2441 |
|---|
| SMILES | Oc1c(NC(=O)Nc2ccccc2)cccc1[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
