Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-1 receptor
LigandBDBM50141468
Substrate/Competitorn/a
Meas. Tech.ChEBML_65489
IC50 0.024000±n/a nM
Citation Takahashi HOhtake NSakamoto TIino TKawanishi NNakamura MYoshizumi TNiiyama KOzaki SOkada HKano ATakahashi HIshii YOkada MSaito MSawazaki YHayama TNishikibe M Structure-activity relationships of a novel class of endothelin receptor selective antagonists; 6-carboxy-2-isopropylamino-5,7-diarylcyclopenteno[1,2-b]pyridines. Bioorg Med Chem Lett 14:1503-7 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Endothelin-1 receptor
Name:Endothelin-1 receptor
Synonyms:EDNRA | ET-A | ETA | ETA-R | ETRA | Endothelin receptor type A | hET-AR
Type:Enzyme Catalytic Domain
Mol. Mass.:48736.88
Organism:Homo sapiens (Human)
Description:P25101
Residue:427
Sequence:
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50141468
n/a
NameBDBM50141468
Synonyms:(5S,6R,7R)-5-Benzo[1,3]dioxol-5-yl-7-[2-(2-dimethylcarbamoyl-propyl)-4-methoxy-phenyl]-2-isopropylamino-6,7-dihydro-5H-[1]pyrindine-6-carboxylic acid | CHEMBL287683
TypeSmall organic molecule
Emp. Form.C32H37N3O6
Mol. Mass.559.6527
SMILESCOc1ccc([C@H]2[C@@H]([C@H](c3ccc(NC(C)C)nc23)c2ccc3OCOc3c2)C(O)=O)c(CC(C)C(=O)N(C)C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: