Reaction Details |
| Report a problem with these data |
Target | Tumor necrosis factor receptor superfamily member 1A |
---|
Ligand | BDBM50141534 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_224214 |
---|
IC50 | 2000±n/a nM |
---|
Citation | Meng, CQ; Zheng, XS; Ni, L; Ye, Z; Simpson, JE; Worsencroft, KJ; Hotema, MR; Weingarten, MD; Skudlarek, JW; Gilmore, JM; Hoong, LK; Hill, RR; Marino, EM; Suen, KL; Kunsch, C; Wasserman, MA; Sikorski, JA Discovery of novel heteroaryl-substituted chalcones as inhibitors of TNF-alpha-induced VCAM-1 expression. Bioorg Med Chem Lett14:1513-7 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor receptor superfamily member 1A |
---|
Name: | Tumor necrosis factor receptor superfamily member 1A |
Synonyms: | CD_antigen=CD120a | TBPI | TNF-R1 | TNF-RI | TNFAR | TNFR-I | TNFR1 | TNFRSF1A | TNR1A_HUMAN | Tumor necrosis factor receptor R1 | Tumor necrosis factor receptor superfamily member 1A | Tumor necrosis factor receptor superfamily member 1A, membrane form | Tumor necrosis factor-binding protein 1 | p55 | p60 |
Type: | PROTEIN |
Mol. Mass.: | 50495.39 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1509419 |
Residue: | 455 |
Sequence: | MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
|
|
|
BDBM50141534 |
---|
n/a |
---|
Name | BDBM50141534 |
Synonyms: | (E)-3-(5-Benzo[b]thiophen-2-yl-2-methoxy-phenyl)-1-(3,4,5-trimethoxy-phenyl)-propenone | CHEMBL36371 |
Type | Small organic molecule |
Emp. Form. | C27H24O5S |
Mol. Mass. | 460.541 |
SMILES | COc1ccc(cc1\C=C\C(=O)c1cc(OC)c(OC)c(OC)c1)-c1cc2ccccc2s1 |
Structure |
|