Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 4 (CCR4)
LigandBDBM50142370
Substrate/Competitorn/a
Meas. Tech.ChEMBL_39491
EC50 600±n/a nM
Citation Allen SNewhouse BAnderson ASFauber BAllen AChantry DEberhardt COdingo JBurgess LE Discovery and SAR of trisubstituted thiazolidinones as CCR4 antagonists. Bioorg Med Chem Lett 14:1619-24 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 4 (CCR4)
Name:C-C chemokine receptor type 4
Synonyms:C-C CKR-4 | C-C chemokine receptor type 4 | CC-CKR-4 | CCR-4 | CCR4 | CD_antigen=CD194 | K5-5
Type:Enzyme
Mol. Mass.:41406.41
Organism:Homo sapiens (Human)
Description:P51679
Residue:360
Sequence:
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVG
FYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50142370
n/a
NameBDBM50142370
Synonyms:2-{(2R,5R)-2-(2,4-Dichloro-phenyl)-5-[((R)-1-naphthalen-1-yl-ethylcarbamoyl)-methyl]-4-oxo-thiazolidin-3-yl}-N-(3-piperidin-1-yl-propyl)-acetamide | CHEMBL42334
TypeSmall organic molecule
Emp. Form.C33H38Cl2N4O3S
Mol. Mass.641.651
SMILESC[C@@H](NC(=O)C[C@H]1S[C@@H](N(CC(=O)NCCCN2CCCCC2)C1=O)c1ccc(Cl)cc1Cl)c1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: