Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA A receptor alpha-2/beta-2/gamma-2
LigandBDBM50142567
Substrate/Competitorn/a
Meas. Tech.ChEBML_68401
Ki 0.300000±n/a nM
Citation Crawforth JAtack JRCook SMGibson KRNadin AOwens APPike ARowley MSmith AJSohal BSternfeld FWafford KStreet LJ Tricyclic pyridones as functionally selective human GABAA alpha 2/3 receptor-ion channel ligands. Bioorg Med Chem Lett 14:1679-82 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GABA A receptor alpha-2/beta-2/gamma-2
Name:Gamma-aminobutyric acid receptor subunit alpha-2/beta-2
Synonyms:GABA receptor alpha-2 subunit | Gamma-aminobutyric acid receptor subunit alpha-2 (GABRA2)
Type:Protein
Mol. Mass.:51338.78
Organism:Homo sapiens (Human)
Description:P47869
Residue:451
Sequence:
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC
PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV
MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM
SRIVFPVLFGTFNLVYWATYLNREPVLGVSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50142567
n/a
NameBDBM50142567
Synonyms:9-(4-Methyl-thiazol-2-yl)-11-phenyl-6,7-dihydro-5H-2,7a-diaza-dibenzo[a,c]cyclohepten-8-one | CHEMBL44533
TypeSmall organic molecule
Emp. Form.C23H19N3OS
Mol. Mass.385.481
SMILESCc1csc(n1)-c1cc(-c2ccccc2)c2-c3cnccc3CCCn2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: