| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18224 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_55237 |
|---|
| IC50 | 0.610000±n/a nM |
|---|
| Citation |  Forsch, RA; Queener, SF; Rosowsky, A Preliminary in vitro studies on two potent, water-soluble trimethoprim analogues with exceptional species selectivity against dihydrofolate reductase from Pneumocystis carinii and Mycobacterium avium. Bioorg Med Chem Lett14:1811-5 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (DHFR) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19884.75 |
|---|
| Organism: | Mycobacterium avium |
|---|
| Description: | Recombinant Mycobacterium avium DHFR expressed in E. coli. |
|---|
| Residue: | 181 |
|---|
| Sequence: | MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRP
LPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEV
TEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRP
S
|
|
|
|---|
| BDBM18224 |
|---|
| n/a |
|---|
| Name | BDBM18224 |
|---|
| Synonyms: | 6-[(2,5-dimethoxyphenyl)methyl]-5-methylpyrido[2,3-d]pyrimidine-2,4-diamine | CHEMBL7492 | PTX | Piritrexim | [2-amino-6-(2,5-dimethoxybenzyl)-5-methyl-pyrido[2,3-d]pyrimidin-4-yl]amine;2-hydroxyethanesulfonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H19N5O2 |
|---|
| Mol. Mass. | 325.3651 |
|---|
| SMILES | COc1ccc(OC)c(Cc2cnc3nc(N)nc(N)c3c2C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
