Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor (Mu)
LigandBDBM50143269
Substrate/Competitorn/a
Meas. Tech.ChEMBL_148096
Ki>5000±n/a nM
Citation Van Cauwenberghe SSimonin FCluzeau JBecker JALubell WDTourwé D Structure-activity study of the ORL1 antagonist Ac-Arg-D-Cha-Qaa-D-Arg-D-p-ClPhe-NH2. J Med Chem 47:1864-7 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor (Mu)
Name:Delta opioid receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:40382.98
Organism:Homo sapiens (Human)
Description:n/a
Residue:372
Sequence:
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50143269
n/a
NameBDBM50143269
Synonyms:7-[2-((S)-2-Acetylamino-5-(R)-guanidino-pentanoylamino)-3-cyclohexyl-propionylamino]-6-oxo-octahydro-quinolizine-4-carboxylic acid ((R)-1-carbamoyl-4-ureido-butyl)-amide | CHEMBL3144464
TypeSmall organic molecule
Emp. Form.C33H57N11O7
Mol. Mass.719.8752
SMILES[H][C@]12[#6]-[#6]-[#6]-[#6@H](-[#7]1-[#6](=O)-[#6@H](-[#6]-[#6]2)-[#7]-[#6](=O)-[#6@@H](-[#6]-[#6]-1-[#6]-[#6]-[#6]-[#6]-[#6]-1)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#7]-[#6](-[#6])=O)-[#6](=O)-[#7]-[#6@H](-[#6]-[#6]-[#6]-[#7]-[#6](-[#7])=O)-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: