| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fibroblast growth factor 2 |
|---|
| Ligand | BDBM50144527 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_70634 |
|---|
| Kd | 200000±n/a nM |
|---|
| Citation |  Liu, L; Ping Li, C; Cochran, S; Ferro, V Application of the four-component Ugi condensation for the preparation of sulfated glycoconjugate libraries. Bioorg Med Chem Lett14:2221-6 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fibroblast growth factor 2 |
|---|
| Name: | Fibroblast growth factor 2 |
|---|
| Synonyms: | Basic fibroblast growth factor | FGF-2 | FGF2 | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 (bFGF) | Fibroblast growth factor receptor 2 (FGF-2) | HBGF-2 | Heparin-binding growth factor 2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30803.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09038 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
|
|
|
|---|
| BDBM50144527 |
|---|
| n/a |
|---|
| Name | BDBM50144527 |
|---|
| Synonyms: | CHEMBL3215305 | Sodium sulfated glycoconjugate derivative |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H33N2Na3O17S3 |
|---|
| Mol. Mass. | 786.686 |
|---|
| SMILES | [Na+].[Na+].[Na+].CO[C@H]1O[C@@H](COCC(=O)N(CC(=O)NC2CCCCC2)Cc2ccccc2)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@H]1OS([O-])(=O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
