Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha
LigandBDBM50146337
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196624
Ki 3.2±n/a nM
Citation Gernert DLNeel DABoehm MFLeibowitz MDMais DAMichellys PYRungta DReifel-Miller AGrese TA Design and synthesis of benzofused heterocyclic RXR modulators. Bioorg Med Chem Lett 14:2759-63 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha
Name:Nuclear receptor subfamily 4 group A member 2/Retinoic acid receptor RXR-alpha
Synonyms:Nuclear receptor subfamily 2 group B member 1 | Nuclear receptor subfamily 4 group A member 2 | Retinoid X receptor alpha | Retinoid receptor
Type:PROTEIN
Mol. Mass.:50820.38
Organism:Homo sapiens (Human)
Description:ChEMBL_1456363
Residue:462
Sequence:
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50146337
n/a
NameBDBM50146337
Synonyms:(E)-3-[3-(2-Butoxy-3,5-di-tert-butyl-phenyl)-1H-indol-5-yl]-but-2-enoic acid | CHEMBL93246
TypeSmall organic molecule
Emp. Form.C30H39NO3
Mol. Mass.461.6356
SMILESCCCCOc1c(cc(cc1C(C)(C)C)C(C)(C)C)-c1c[nH]c2ccc(cc12)C(\C)=C\C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: