Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50146643
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157738
Ki 0.1±n/a nM
Citation Pierce ACRao GBemis GW BREED: Generating novel inhibitors through hybridization of known ligands. Application to CDK2, p38, and HIV protease. J Med Chem 47:2768-75 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50146643
n/a
NameBDBM50146643
Synonyms:CHEMBL94384 | N*1*-{(1S,2R)-3-[(3H-Benzo[1,2,5]oxadiazole-1-sulfonyl)-isobutyl-amino]-1-benzyl-2-hydroxy-propyl}-2-[((S)-quinoline-2-carbonyl)-amino]-succinamide
TypeSmall organic molecule
Emp. Form.C34H39N7O7S
Mol. Mass.689.781
SMILESCC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)c1ccc2ccccc2n1)S(=O)(=O)N1ONc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: