| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50146643 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157738 (CHEMBL765176) |
|---|
| Ki | 0.1±n/a nM |
|---|
| Citation |  Pierce, AC; Rao, G; Bemis, GW BREED: Generating novel inhibitors through hybridization of known ligands. Application to CDK2, p38, and HIV protease. J Med Chem47:2768-75 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50146643 |
|---|
| n/a |
|---|
| Name | BDBM50146643 |
|---|
| Synonyms: | CHEMBL94384 | N*1*-{(1S,2R)-3-[(3H-Benzo[1,2,5]oxadiazole-1-sulfonyl)-isobutyl-amino]-1-benzyl-2-hydroxy-propyl}-2-[((S)-quinoline-2-carbonyl)-amino]-succinamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H39N7O7S |
|---|
| Mol. Mass. | 689.781 |
|---|
| SMILES | CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)c1ccc2ccccc2n1)S(=O)(=O)N1ONc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
