Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetComplement C1s
LigandBDBM50099917
Substrate/Competitorn/a
Meas. Tech.ChEBML_48032
Ki 870.0±n/a nM
Citation Subasinghe NLAli FIllig CRJonathan Rudolph MKlein SKhalil ESoll RMBone RFSpurlino JCDesJarlais RLCrysler CSCummings MDMorris PEKilpatrick JMSudhakara Babu Y A novel series of potent and selective small molecule inhibitors of the complement component C1s. Bioorg Med Chem Lett 14:3043-7 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Complement C1s
Name:Complement C1s
Synonyms:C1 esterase | Complement C1s subcomponent | Complement C1s subcomponent heavy chain | Complement C1s subcomponent light chain | Complement component 1 subcomponent s | Trypsin | complement component 1, s subcomponent
Type:Protein
Mol. Mass.:76657.91
Organism:Homo sapiens (Human)
Description:P09871
Residue:688
Sequence:
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099917
n/a
NameBDBM50099917
Synonyms:4-[4-(4-Chloro-pyridin-3-yl)-thiazol-2-yl]-5-methylsulfanyl-thiophene-2-carboxamidine | CHEMBL28723
TypeSmall organic molecule
Emp. Form.C14H11ClN4S3
Mol. Mass.366.912
SMILESCSc1sc(cc1-c1nc(cs1)-c1cnccc1Cl)C(N)=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: