| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-1 |
|---|
| Ligand | BDBM50147096 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_148015 |
|---|
| Ki | 100±n/a nM |
|---|
| Citation |  Wendt, MD; Geyer, A; McClellan, WJ; Rockway, TW; Weitzberg, M; Zhao, X; Mantei, R; Stewart, K; Nienaber, V; Klinghofer, V; Giranda, VL Interaction with the S1 beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors. Bioorg Med Chem Lett14:3063-8 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-1 |
|---|
| Name: | Kallikrein-1 |
|---|
| Synonyms: | KLK1 | KLK1_HUMAN | Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28874.69 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06870 |
|---|
| Residue: | 262 |
|---|
| Sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
|
|
|
|---|
| BDBM50147096 |
|---|
| n/a |
|---|
| Name | BDBM50147096 |
|---|
| Synonyms: | 6-Carbamimidoyl-4-(pyrimidin-2-ylamino)-naphthalene-2-carboxylic acid phenylamide | CHEMBL104505 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18N6O |
|---|
| Mol. Mass. | 382.4179 |
|---|
| SMILES | NC(=N)c1ccc2cc(cc(Nc3ncccn3)c2c1)C(=O)Nc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
