Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein-1 (KLK1)
LigandBDBM50147093
Substrate/Competitorn/a
Meas. Tech.ChEBML_148015
Ki 40±n/a nM
Citation Wendt MDGeyer AMcClellan WJRockway TWWeitzberg MZhao XMantei RStewart KNienaber VKlinghofer VGiranda VL Interaction with the S1 beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors. Bioorg Med Chem Lett 14:3063-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kallikrein-1 (KLK1)
Name:Kallikrein 1
Synonyms:Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein
Type:Enzyme
Mol. Mass.:28874.69
Organism:Homo sapiens (Human)
Description:P06870
Residue:262
Sequence:
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50147093
n/a
NameBDBM50147093
Synonyms:6-Carbamimidoyl-4-(pyrimidin-2-ylamino)-naphthalene-2-carboxylic acid (4-aminomethyl-phenyl)-amide | 6-[(Z)-AMINO(IMINO)METHYL]-N-[4-(AMINOMETHYL)PHENYL]-4-(PYRIMIDIN-2-YLAMINO)-2-NAPHTHAMIDE | CHEMBL104166 | N-(4-(aminomethyl)phenyl)-6-carbamimidoyl-4-(pyrimidin-2-ylamino)-2-naphthamide
TypeSmall organic molecule
Emp. Form.C23H21N7O
Mol. Mass.411.4591
SMILESNCc1ccc(NC(=O)c2cc(Nc3ncccn3)c3cc(ccc3c2)C(N)=N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: