Reaction Details |
| Report a problem with these data |
Target | Kallikrein-1 |
---|
Ligand | BDBM50147092 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_148015 |
---|
Ki | 1900±n/a nM |
---|
Citation | Wendt, MD; Geyer, A; McClellan, WJ; Rockway, TW; Weitzberg, M; Zhao, X; Mantei, R; Stewart, K; Nienaber, V; Klinghofer, V; Giranda, VL Interaction with the S1 beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors. Bioorg Med Chem Lett14:3063-8 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Kallikrein-1 |
---|
Name: | Kallikrein-1 |
Synonyms: | KLK1 | KLK1_HUMAN | Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein |
Type: | Enzyme |
Mol. Mass.: | 28874.69 |
Organism: | Homo sapiens (Human) |
Description: | P06870 |
Residue: | 262 |
Sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
|
|
|
BDBM50147092 |
---|
n/a |
---|
Name | BDBM50147092 |
Synonyms: | 8-Amino-naphthalene-2-carboxamidine | 8-amino-2-naphthimidamide | CHEMBL319264 | uPa_15 |
Type | Small organic molecule |
Emp. Form. | C11H11N3 |
Mol. Mass. | 185.2251 |
SMILES | NC(=N)c1ccc2cccc(N)c2c1 |
Structure |
|