Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50147091
Substrate/Competitorn/a
Meas. Tech.ChEBML_213066
Ki 3.5±n/a nM
Citation Wendt MDGeyer AMcClellan WJRockway TWWeitzberg MZhao XMantei RStewart KNienaber VKlinghofer VGiranda VL Interaction with the S1 beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors. Bioorg Med Chem Lett 14:3063-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50147091
n/a
NameBDBM50147091
Synonyms:6-Carbamimidoyl-4-(5-ethanesulfonyl-furan-3-yl)-naphthalene-2-carboxylic acid phenylamide | CHEMBL321319
TypeSmall organic molecule
Emp. Form.C24H21N3O4S
Mol. Mass.447.506
SMILESCCS(=O)(=O)c1cc(co1)-c1cc(cc2ccc(cc12)C(N)=N)C(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: