Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrokinase-type plasminogen activator
LigandBDBM50147099
Substrate/Competitorn/a
Meas. Tech.ChEBML_210760
Ki 2100±n/a nM
Citation Wendt MDGeyer AMcClellan WJRockway TWWeitzberg MZhao XMantei RStewart KNienaber VKlinghofer VGiranda VL Interaction with the S1 beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors. Bioorg Med Chem Lett 14:3063-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Urokinase-type plasminogen activator
Name:Urokinase-type plasminogen activator/surface receptor
Synonyms:U-plasminogen activator | Urokinase | Urokinase-type plasminogen activator (uPA)
Type:Enzyme
Mol. Mass.:48528.62
Organism:Homo sapiens (Human)
Description:P00749
Residue:431
Sequence:
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50147099
n/a
NameBDBM50147099
Synonyms:8-(furan-2-yl)-7-methoxy-2-naphthimidamide | 8-Furan-2-yl-7-methoxy-naphthalene-2-carboxamidine | CHEMBL418805
TypeSmall organic molecule
Emp. Form.C16H14N2O2
Mol. Mass.266.2946
SMILESCOc1ccc2ccc(cc2c1-c1ccco1)C(N)=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: