Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-Phosphate Receptor 2
LigandBDBM50158348
Substrate/Competitorn/a
Meas. Tech.ChEMBL_201454
IC50 0.230000±n/a nM
Citation Hale JJNeway WMills SGHajdu RAnn Keohane CRosenbach MMilligan JShei GJChrebet GBergstrom JCard DKoo GCKoprak SLJackson JJRosen HMandala S Potent S1P receptor agonists replicate the pharmacologic actions of the novel immune modulator FTY720. Bioorg Med Chem Lett 14:3351-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-Phosphate Receptor 2
Name:Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
Synonyms:S1P2 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:38883.16
Organism:Homo sapiens (Human)
Description:Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay.
Residue:353
Sequence:
MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158348
n/a
NameBDBM50158348
Synonyms:(2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate | (2S,3R,4E)-2-amino-4-octadecene-1,3-diol 1-(dihydrogen phosphate) | CHEMBL225155 | sphingosine 1-phosphate | sphingosine-1-phosphate
TypeSmall organic molecule
Emp. Form.C18H38NO5P
Mol. Mass.379.4718
SMILESCCCCCCCCCCCCC\C=C\[C@@H](O)[C@@H](N)COP(O)(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: