Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM50147703 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201454 (CHEMBL807599) |
---|
IC50 | 33±n/a nM |
---|
Citation | Hale, JJ; Neway, W; Mills, SG; Hajdu, R; Ann Keohane, C; Rosenbach, M; Milligan, J; Shei, GJ; Chrebet, G; Bergstrom, J; Card, D; Koo, GC; Koprak, SL; Jackson, JJ; Rosen, H; Mandala, S Potent S1P receptor agonists replicate the pharmacologic actions of the novel immune modulator FTY720. Bioorg Med Chem Lett14:3351-5 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM50147703 |
---|
n/a |
---|
Name | BDBM50147703 |
Synonyms: | CHEMBL115554 | CHEMBL115713 | [(1S,3R)-3-Amino-1-hydroxy-5-(4-octyl-phenyl)-pentyl]-phosphonic acid |
Type | Small organic molecule |
Emp. Form. | C19H34NO4P |
Mol. Mass. | 371.4513 |
SMILES | CCCCCCCCc1ccc(CC[C@@H](N)CC(=O)P(O)(O)O)cc1 |
Structure |
|