Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM50090697
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29102
Ki 1.62±n/a nM
Citation Ferrarini PLBetti LCavallini TGiannaccini GLucacchini AManera CMartinelli AOrtore GSaccomanni GTuccinardi T Study on affinity profile toward native human and bovine adenosine receptors of a series of 1,8-naphthyridine derivatives. J Med Chem 47:3019-31 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low
Type:Enzyme Catalytic Domain
Mol. Mass.:36602.99
Organism:BOVINE
Description:ADENOSINE 0 BOVINE::P28190
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPVDEDAPAERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50090697
n/a
NameBDBM50090697
Synonyms:7-Chloro-2-phenyl-[1,8]naphthyridin-4-ol | 7-chloro-2-phenyl-1,8-naphthyridin-4-ol | CHEMBL97760
TypeSmall organic molecule
Emp. Form.C14H9ClN2O
Mol. Mass.256.687
SMILESOc1cc(nc2nc(Cl)ccc12)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: