Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50148078 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_147033 (CHEMBL753674) |
---|
Ki | 841000±n/a nM |
---|
Citation | Spetea, M; Schüllner, F; Moisa, RC; Berzetei-Gurske, IP; Schraml, B; Dörfler, C; Aceto, MD; Harris, LS; Coop, A; Schmidhammer, H Synthesis and biological evaluation of 14-alkoxymorphinans. 21. Novel 4-alkoxy and 14-phenylpropoxy derivatives of the mu opioid receptor antagonist cyprodime. J Med Chem47:3242-7 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50148078 |
---|
n/a |
---|
Name | BDBM50148078 |
Synonyms: | 17-cyclopropylmethyl-10-methoxy-13-oxo-(1R,9R,10S)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-3-yl 3-phenyl-(E)-2-propenoate | CHEMBL109786 |
Type | Small organic molecule |
Emp. Form. | C30H33NO4 |
Mol. Mass. | 471.5873 |
SMILES | CO[C@@]12CCC(=O)CC11CCN(CC3CC3)[C@@H]2Cc2cccc(OC(=O)\C=C\c3ccccc3)c12 |TLB:12:11:2:34.18.17| |
Structure |
|