Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1
LigandBDBM50148435
Substrate/Competitorn/a
Meas. Tech.ChEBML_201315
IC50 0.600000±n/a nM
Citation Hale JJDoherty GToth LMills SGHajdu RKeohane CARosenbach MMilligan JShei GJChrebet GBergstrom JCard DForrest MSun SYWest SXie HNomura NRosen HMandala S Selecting against S1P3 enhances the acute cardiovascular tolerability of 3-(N-benzyl)aminopropylphosphonic acid S1P receptor agonists. Bioorg Med Chem Lett 14:3501-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1
Name:Sphingosine 1-phosphate receptor
Synonyms:CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148435
n/a
NameBDBM50148435
Synonyms:CHEMBL119116 | [3-(3,5-Dichloro-4-octyloxy-benzylamino)-propyl]-phosphonic acid
TypeSmall organic molecule
Emp. Form.C18H30Cl2NO4P
Mol. Mass.426.315
SMILESCCCCCCCCOc1c(Cl)cc(CNCCCP(O)(O)=O)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: