Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor Edg-4
LigandBDBM50148439
Substrate/Competitorn/a
Meas. Tech.ChEBML_201449
IC50 80±n/a nM
Citation Hale JJDoherty GToth LMills SGHajdu RKeohane CARosenbach MMilligan JShei GJChrebet GBergstrom JCard DForrest MSun SYWest SXie HNomura NRosen HMandala S Selecting against S1P3 enhances the acute cardiovascular tolerability of 3-(N-benzyl)aminopropylphosphonic acid S1P receptor agonists. Bioorg Med Chem Lett 14:3501-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor Edg-4
Name:Lysophosphatidic acid receptor Edg-4
Synonyms:LPA receptor 2 | LPA-2 | Lysophosphatidic acid receptor 2
Type:PROTEIN
Mol. Mass.:39103.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1451385
Residue:351
Sequence:
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148439
n/a
NameBDBM50148439
Synonyms:3-(3-bromo-5-methoxy-4-(octyloxy)benzylamino)propylphosphonic acid | CHEMBL117723 | [3-(3-Bromo-5-methoxy-4-octyloxy-benzylamino)-propyl]-phosphonic acid
TypeSmall organic molecule
Emp. Form.C19H33BrNO5P
Mol. Mass.466.347
SMILESCCCCCCCCOc1c(Br)cc(CNCCCP(O)(O)=O)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: