Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 14 |
---|
Ligand | BDBM50148703 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_124496 |
---|
IC50 | 4±n/a nM |
---|
Citation | Revesz, L; Blum, E; Di Padova, FE; Buhl, T; Feifel, R; Gram, H; Hiestand, P; Manning, U; Rucklin, G Novel p38 inhibitors with potent oral efficacy in several models of rheumatoid arthritis. Bioorg Med Chem Lett14:3595-9 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitogen-activated protein kinase 14 |
---|
Name: | Mitogen-activated protein kinase 14 |
Synonyms: | Crk1 | Csbp1 | Csbp2 | MAP Kinase p38 alpha | MAP kinase p38 | MK14_MOUSE | Mapk14 | Mitogen-activated protein kinase 14 | Mitogen-activated protein kinase p38 alpha |
Type: | Enzyme |
Mol. Mass.: | 41281.22 |
Organism: | Mus musculus (mouse) |
Description: | The full-length open reading frame of murine p38 alpha was cloned and expressed in E. coli.. Soluble murine p38R was extracted from cell pellets and purified using ion-exchange chromatography. |
Residue: | 360 |
Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
BDBM50148703 |
---|
n/a |
---|
Name | BDBM50148703 |
Synonyms: | 4-[5-(2-Cyclohexylamino-pyridin-4-yl)-4-(4-fluoro-phenyl)-thiazol-2-yl]-piperidin-4-ol | CHEMBL119699 |
Type | Small organic molecule |
Emp. Form. | C25H29FN4OS |
Mol. Mass. | 452.587 |
SMILES | OC1(CCNCC1)c1nc(c(s1)-c1ccnc(NC2CCCCC2)c1)-c1ccc(F)cc1 |
Structure |
|