Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50150033
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302271
Ki 1.37±n/a nM
Citation Huang PPRandolph JTKlein LLVasavanonda SDekhtyar TStoll VSKempf DJ Synthesis and antiviral activity of P1' arylsulfonamide azacyclic urea HIV protease inhibitors. Bioorg Med Chem Lett 14:4075-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150033
n/a
NameBDBM50150033
Synonyms:(5R,6R)-1-Benzenesulfonyl-5-benzyl-6-hydroxy-2,4-bis-(4-hydroxy-benzyl)-[1,2,4]triazepan-3-one | CHEMBL183451
TypeSmall organic molecule
Emp. Form.C31H31N3O6S
Mol. Mass.573.659
SMILESO[C@@H]1CN(N(Cc2ccc(O)cc2)C(=O)N(Cc2ccc(O)cc2)[C@@H]1Cc1ccccc1)S(=O)(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: