Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; Norepinephrine & serotonin
LigandBDBM50150103
Substrate/Competitorn/a
Meas. Tech.ChEMBL_201813
Ki 0.39±n/a nM
Citation Mewshaw REZhou DZhou PShi XHornby GSpangler TScerni RSmith DSchechter LEAndree TH Studies toward the discovery of the next generation of antidepressants. 3. Dual 5-HT1A and serotonin transporter affinity within a class of N-aryloxyethylindolylalkylamines. J Med Chem 47:3823-42 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; Norepinephrine & serotonin
Name:Monoamine transporters; Norepinephrine & serotonin
Synonyms:5-HT Transporter | 5-HTT | 5HT transporter | 5HTT | Anandamid membrane transporter, AMT | Anandamide membrane transporter, AMT | Sodium-dependent serotonin transporter (SERT) | imipramine receptor
Type:Multi-pass membrane protein
Mol. Mass.:70168.43
Organism:Rattus norvegicus (rat)
Description:P31652
Residue:630
Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEAS
HSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150103
n/a
NameBDBM50150103
Synonyms:CHEMBL338520 | [2-(6-Chloro-1H-benzoimidazol-4-yloxy)-ethyl]-[3-(5-fluoro-1H-indol-3-yl)-propyl]-amine
TypeSmall organic molecule
Emp. Form.C20H20ClFN4O
Mol. Mass.386.85
SMILESFc1ccc2[nH]cc(CCCNCCOc3cc(Cl)cc4[nH]cnc34)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: