Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target12-Lipoxygenase (12-LOX)
LigandBDBM50135851
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305339
IC50 410±n/a nM
Citation Segraves ENShah RRSegraves NLJohnson TAWhitman SSui JKKenyon VACichewicz RHCrews PHolman TR Probing the activity differences of simple and complex brominated aryl compounds against 15-soybean, 15-human, and 12-human lipoxygenase. J Med Chem 47:4060-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
12-Lipoxygenase (12-LOX)
Name:Arachidonate 12-lipoxygenase
Synonyms:12-LOX | Arachidonate 12-lipoxygenase | Arachidonate 12-lipoxygenase, 12S-type | Platelet 12-lipoxygenase | Platelet-type lipoxygenase 12
Type:Protein
Mol. Mass.:75689.18
Organism:Homo sapiens (Human)
Description:P18054
Residue:663
Sequence:
MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVH
LFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135851
n/a
NameBDBM50135851
Synonyms:2,3,4,5-tetrabromo-6-(3,5-dibromo-2-hydroxy-phenoxy)-phenol | 2,3,4,5-tetrabromo-6-(3,5-dibromo-2-hydroxyphenoxy)phenol | CHEMBL150098
TypeSmall organic molecule
Emp. Form.C12H4Br6O3
Mol. Mass.675.582
SMILESOc1c(Br)cc(Br)cc1Oc1c(O)c(Br)c(Br)c(Br)c1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: