Reaction Details |
| Report a problem with these data |
Target | Melanocortin receptor 5 |
---|
Ligand | BDBM50151511 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302998 (CHEMBL830237) |
---|
Ki | 5000±n/a nM |
---|
Citation | Mutulis, F; Yahorava, S; Mutule, I; Yahorau, A; Liepinsh, E; Kopantshuk, S; Veiksina, S; Tars, K; Belyakov, S; Mishnev, A; Rinken, A; Wikberg, JE New substituted piperazines as ligands for melanocortin receptors. Correlation to the X-ray structure of"THIQ". J Med Chem47:4613-26 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocortin receptor 5 |
---|
Name: | Melanocortin receptor 5 |
Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
Type: | Enzyme |
Mol. Mass.: | 36612.92 |
Organism: | Homo sapiens (Human) |
Description: | P33032 |
Residue: | 325 |
Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
BDBM50151511 |
---|
n/a |
---|
Name | BDBM50151511 |
Synonyms: | 1,2,3,4-Tetrahydro-isoquinoline-3-carboxylic acid [(R)-1-(4-chloro-benzyl)-2-(4-cyclohexyl-4-[1,2,4]triazol-1-ylmethyl-piperidin-1-yl)-2-oxo-ethyl]-amide | CHEMBL433750 | N-((R)-1-(4-((1H-1,2,4-triazol-1-yl)methyl)-4-cyclohexylpiperidin-1-yl)-3-(4-chlorophenyl)-1-oxopropan-2-yl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide |
Type | Small organic molecule |
Emp. Form. | C33H41ClN6O2 |
Mol. Mass. | 589.171 |
SMILES | Clc1ccc(C[C@@H](NC(=O)C2Cc3ccccc3CN2)C(=O)N2CCC(Cn3cncn3)(CC2)C2CCCCC2)cc1 |
Structure |
|