Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOligopeptide transporter small intestine isoform
LigandBDBM50152063
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306163
IC50 134000±n/a nM
Citation Våbenø JNielsen CUIngebrigtsen TLejon TSteffansen BLuthman K Dipeptidomimetic ketomethylene isosteres as pro-moieties for drug transport via the human intestinal di-/tripeptide transporter hPEPT1: design, synthesis, stability, and biological investigations. J Med Chem 47:4755-65 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oligopeptide transporter small intestine isoform
Name:Oligopeptide transporter small intestine isoform
Synonyms:Intestinal H(+)/peptide cotransporter | Oligopeptide transporter, small intestine isoform | Peptide transporter 1
Type:PROTEIN
Mol. Mass.:78818.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1488839
Residue:708
Sequence:
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50152063
n/a
NameBDBM50152063
Synonyms:5-Amino-6-methyl-4-oxo-heptanoic acid benzyl ester | CHEMBL189248
TypeSmall organic molecule
Emp. Form.C15H21NO3
Mol. Mass.263.3321
SMILESCC(C)[C@H](N)C(=O)CCC(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: