| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen B |
|---|
| Ligand | BDBM50152751 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302381 (CHEMBL830349) |
|---|
| Ki | >50000±n/a nM |
|---|
| Citation |  Yip, Y; Victor, F; Lamar, J; Johnson, R; Wang, QM; Glass, JI; Yumibe, N; Wakulchik, M; Munroe, J; Chen, SH P4 and P1' optimization of bicycloproline P2 bearing tetrapeptidyl alpha-ketoamides as HCV protease inhibitors. Bioorg Med Chem Lett14:5007-11 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen B |
|---|
| Name: | Chymotrypsinogen B |
|---|
| Synonyms: | A0A2R8YG87_HUMAN | Beta-chymotrypsin | CTRB1 | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27871.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_216634 |
|---|
| Residue: | 263 |
|---|
| Sequence: | MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
|---|
| BDBM50152751 |
|---|
| n/a |
|---|
| Name | BDBM50152751 |
|---|
| Synonyms: | 2-((S)-2-{(S)-2-Cyclohexyl-2-[((R)-pyrazine-2-carbonyl)-amino]-acetylamino}-3,3-dimethyl-butyryl)-octahydro-cyclopenta[c]pyrrole-1-carboxylic acid [1-(1-phenyl-ethylaminooxalyl)-butyl]-amide | CHEMBL184035 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H57N7O6 |
|---|
| Mol. Mass. | 743.9346 |
|---|
| SMILES | CCCC(NC(=O)[C@@H]1C2CCCC2CN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)c1cnccn1)C1CCCCC1)C(C)(C)C)C(=O)C(=O)N[C@H](C)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
