Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen B |
---|
Ligand | BDBM50137733 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302381 (CHEMBL830349) |
---|
Ki | >50000±n/a nM |
---|
Citation | Yip, Y; Victor, F; Lamar, J; Johnson, R; Wang, QM; Glass, JI; Yumibe, N; Wakulchik, M; Munroe, J; Chen, SH P4 and P1' optimization of bicycloproline P2 bearing tetrapeptidyl alpha-ketoamides as HCV protease inhibitors. Bioorg Med Chem Lett14:5007-11 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen B |
---|
Name: | Chymotrypsinogen B |
Synonyms: | A0A2R8YG87_HUMAN | Beta-chymotrypsin | CTRB1 | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B |
Type: | PROTEIN |
Mol. Mass.: | 27871.19 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_216634 |
Residue: | 263 |
Sequence: | MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
BDBM50137733 |
---|
n/a |
---|
Name | BDBM50137733 |
Synonyms: | (1S,5S,6R)-2-((S)-3,3-Dimethyl-2-{(S)-3-methyl-2-[(pyrazine-2-carbonyl)-amino]-butyrylamino}-butyryl)-octahydro-cyclopenta[c]pyrrole-1-carboxylic acid [1-((S)-cyclopropylaminooxalyl)-butyl]-amide | CHEMBL86453 |
Type | Small organic molecule |
Emp. Form. | C33H49N7O6 |
Mol. Mass. | 639.7855 |
SMILES | CCC[C@H](NC(=O)[C@@H]1[C@H]2CCC[C@H]2CN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)c1cnccn1)C(C)C)C(C)(C)C)C(=O)C(=O)NC1CC1 |
Structure |
|