| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50153080 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303553 (CHEMBL828953) |
|---|
| Ki | 23±n/a nM |
|---|
| Citation |  Hu, X; Nguyen, KT; Jiang, VC; Lofland, D; Moser, HE; Pei, D Macrocyclic inhibitors for peptide deformylase: a structure-activity relationship study of the ring size. J Med Chem47:4941-9 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | 3.5.1.88 | BON69_24600 | BON94_18585 | D9G11_24945 | D9G11_25760 | D9J60_20755 | FORC82_p394 | PDF | Polypeptide deformylase | SAMEA3472033_04733 | def | def_2 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 16901.39 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 150 |
|---|
| Sequence: | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
|
|
|
|---|
| BDBM50153080 |
|---|
| n/a |
|---|
| Name | BDBM50153080 |
|---|
| Synonyms: | (R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoic acid [5-amino-1-((S)-phenylcarbamoyl)-pentyl]-amide | CHEMBL360609 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H32N4O4 |
|---|
| Mol. Mass. | 392.4925 |
|---|
| SMILES | CCCC[C@H](CN(O)C=O)C(=O)N[C@@H](CCCCN)C(=O)Nc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
