Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptide deformylase
LigandBDBM50153086
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303545
Ki 3±n/a nM
Citation Hu XNguyen KTJiang VCLofland DMoser HEPei D Macrocyclic inhibitors for peptide deformylase: a structure-activity relationship study of the ring size. J Med Chem 47:4941-9 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptide deformylase
Name:Peptide deformylase
Synonyms:PDF | Polypeptide deformylase | def
Type:n/a
Mol. Mass.:16901.39
Organism:Escherichia coli
Description:n/a
Residue:150
Sequence:
MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153086
n/a
NameBDBM50153086
Synonyms:CHEMBL188671 | N-[(1R,2S)-3-(4-Amino-butyl)-2,5-dioxo-1,4diaza-cyclopentadec-6-ylmethyl]-N-hydroxy-formamide
TypeSmall organic molecule
Emp. Form.C19H36N4O4
Mol. Mass.384.5135
SMILESNCCCC[C@@H]1NC(=O)[C@@H](CN(O)C=O)CCCCCCCCCNC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: