Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50154041
Substrate/Competitorn/a
Meas. Tech.ChEMBL_310387
EC50 153±n/a nM
Citation Breslin HJMiskowski TARafferty BMCoutinho SVPalmer JMWallace NHSchneider CRKimball ESZhang SPLi JColburn RWStone DJMartinez RPHe W Rationale, design, and synthesis of novel phenyl imidazoles as opioid receptor agonists for gastrointestinal disorders. J Med Chem 47:5009-20 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50154041
n/a
NameBDBM50154041
Synonyms:(S)-2-amino-3-(4-hydroxyphenyl)-1-((S)-2-(5-methyl-4-phenyl-1H-imidazol-2-yl)piperidin-1-yl)propan-1-one | 2-Amino-3-(4-hydroxy-phenyl)-1-[2-(5-methyl-4-phenyl-1H-imidazol-2-yl)-piperidin-1-yl]-propan-1-one | CHEMBL366311
TypeSmall organic molecule
Emp. Form.C24H28N4O2
Mol. Mass.404.5047
SMILESCc1[nH]c(nc1-c1ccccc1)[C@@H]1CCCCN1C(=O)[C@@H](N)Cc1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: