Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPalmitoyl-CoA oxidase
LigandBDBM50138599
Substrate/Competitorn/a
Meas. Tech.ChEMBL_312558
IC50 2500±n/a nM
Citation Elzein EIbrahim PKoltun DORehder KShenk KDMarquart TAJiang BLi XNatero RLi YNguyen MKerwar SChu NSoohoo DHao JMaydanik VYLustig DAZeng DLeung KZablocki JA CVT-4325: a potent fatty acid oxidation inhibitor with favorable oral bioavailability. Bioorg Med Chem Lett 14:6017-21 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Palmitoyl-CoA oxidase
Name:Palmitoyl-CoA oxidase
Synonyms:AOX | Peroxisomal acyl-CoA oxidase 1, A chain | Peroxisomal acyl-CoA oxidase 1, B chain | Peroxisomal acyl-CoA oxidase 1, C chain | Peroxisomal acyl-coenzyme A oxidase 1
Type:PROTEIN
Mol. Mass.:74693.04
Organism:Rattus norvegicus
Description:ChEMBL_311972
Residue:661
Sequence:
MNPDLRKERASATFNPELITHILDGSPENTRRRREIENLILNDPDFQHEDYNFLTRSQRY
EVAVKKSATMVKKMREYGISDPEEIMWFKKLYLANFVEPVGLNYSMFIPTLLNQGTTAQQ
EKWMRPSQELQIIGTYAQTEMGHGTHLRGLETTATYDPKTQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITQGECYGLHAFVVPIREIGTHKPLPGITVGDIGPKFGYEEMDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGNAAQSLSKACTIA
IRYSAVRRQSEIKQSEPEPQILDFQTQQYKLFPLLATAYAFHFVGRYMKETYLRINESIG
QGDLSELPELHALTAGLKAFTTWTANAGIEECRMACGGHGYSHSSGIPNIYVTFTPACTF
EGENTVMMLQTARFLMKIYDQVRSGKLVGGMVSYLNDLPSQRIQPQQVAVWPTMVDINSL
EGLTEAYKLRAARLVEIAAKNLQTHVSHRKSKEVAWNLTSVDLVRASEAHCHYVVVKVFS
DKLPKIQDKAVQAVLRNLCLLYSLYGISQKGGDFLEGSIITGAQLSQVNARILELLTLIR
PNAVALVDAFDFKDMTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYHKHLKPLQSK
L
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138599
n/a
NameBDBM50138599
Synonyms:CHEMBL154751 | N-(2,6-Dimethyl-phenyl)-2-{4-[(R)-2-hydroxy-3-(2-methyl-benzothiazol-5-yloxy)-propyl]-piperazin-1-yl}-acetamide
TypeSmall organic molecule
Emp. Form.C25H32N4O3S
Mol. Mass.468.612
SMILESCc1nc2cc(OC[C@H](O)CN3CCN(CC(=O)Nc4c(C)cccc4C)CC3)ccc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: