Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50156446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302897
Ki 0.02±n/a nM
Citation Su DSMarkowitz MKMurphy KLWan BLZrada MMHarrell CMO'Malley SSHess JFRansom RWChang RSWallace MARaab CEDean DCPettibone DJFreidinger RMBock MG Development of an efficient and selective radioligand for bradykinin B1 receptor occupancy studies. Bioorg Med Chem Lett 14:6045-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156446
n/a
NameBDBM50156446
Synonyms:CHEMBL359553 | N-{2-[4-(4,5-Dihydro-1H-imidazol-2-yl)-phenyl]-ethyl}-2-[(R)-1-(naphthalene-2-sulfonyl)-3-oxo-1,2,3,4-tetrahydro-quinoxalin-2-yl]-acetamide
TypeSmall organic molecule
Emp. Form.C31H29N5O4S
Mol. Mass.567.658
SMILESO=C(C[C@H]1N(c2ccccc2NC1=O)S(=O)(=O)c1ccc2ccccc2c1)NCCc1ccc(cc1)C1=NCCN1 |t:41|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: