| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tubulin beta chain [1-43] |
|---|
| Ligand | BDBM50156488 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_311631 (CHEMBL833941) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Kim, S; Park, JH; Koo, SY; Kim, JI; Kim, MH; Kim, JE; Jo, K; Choi, HG; Lee, SB; Jung, SH Novel diarylsulfonylurea derivatives as potent antimitotic agents. Bioorg Med Chem Lett14:6075-8 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tubulin beta chain [1-43] |
|---|
| Name: | Tubulin beta chain [1-43] |
|---|
| Synonyms: | Beta tubulin | TBB_LEIME |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 4652.47 |
|---|
| Organism: | Leishmania donovani |
|---|
| Description: | ChEMBL_311916 |
|---|
| Residue: | 43 |
|---|
| Sequence: | MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQ
|
|
|
|---|
| BDBM50156488 |
|---|
| n/a |
|---|
| Name | BDBM50156488 |
|---|
| Synonyms: | 1-[1-(Furan-2-carbonyl)-2,3-dihydro-1H-indole-5-sulfonyl]-4-thiophen-2-yl-imidazolidin-2-one | CHEMBL190702 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H17N3O5S2 |
|---|
| Mol. Mass. | 443.496 |
|---|
| SMILES | O=C(N1CCc2cc(ccc12)S(=O)(=O)N1CC(NC1=O)c1cccs1)c1ccco1 |
|---|
| Structure | 
|
|---|
Search and Browse
