Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50156859
Substrate/Competitorn/a
Meas. Tech.ChEMBL_429751
IC50 150±n/a nM
Citation Fonquerna SMiralpeix MPagès LPuig CCardús AAntón FCárdenas AVilella DAparici MCalaf EPrieto JGras JHuerta JMWarrellow GBeleta JRyder H Synthesis and structure-activity relationships of novel histamine H1 antagonists: indolylpiperidinyl benzoic acid derivatives. J Med Chem 47:6326-37 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:55641.53
Organism:Cavia porcellus (domestic guinea pig)
Description:Guinea pig cerebellum was used in binding assay.
Residue:488
Sequence:
MSFLPGMTPVTLSNFSWALEDRMLEGNSTTTPTRQLMPLVVVLSSVSLVTVALNLLVLYA
VRSERKLHTVGNLYIVSLSVADLIVGAVVMPMSILYLHRSAWILGRPLCLFWLSMDYVAS
TASIFSVFILCIDRYRSVQQPLRYLRYRTKTRASATILGAWLLSFLWVIPILGWHHFMAP
TSEPREKKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYIRIYKAVRRHCQHRQLINSSL
PSFSEMKLKLENAKVDTRRMGKESPWEDPKRCSKDASGVHTPMPSSQHLVDMPCAAVLSE
DEGGEVGTRQMPMLAVGDGRCCEALNHMHSQLELSGQSRATHSISARPEEWTVVDGQSFP
ITDSDTSTEAAPMGGQPRSGSNSGLDYIKFTWRRLRSHSRQYTSGLHLNRERKAAKQLGC
IMAAFILCWIPYFVFFMVIAFCKSCSNEPVHMFTIWLGYLNSTLNPLIYPLCNENFRKTF
KRILRIPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156859
n/a
NameBDBM50156859
Synonyms:2-(2-(4-(5-bromo-1-(2-ethoxyethyl)-1H-indol-3-yl)piperidin-1-yl)ethoxy)benzoic acid | CHEMBL387390
TypeSmall organic molecule
Emp. Form.C26H31BrN2O4
Mol. Mass.515.439
SMILESCCOCCn1cc(C2CCN(CCOc3ccccc3C(O)=O)CC2)c2cc(Br)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: